PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA30G00287
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family MYB
Protein Properties Length: 309aa    MW: 35483.7 Da    PI: 6.6451
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA30G00287genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding491.4e-151462148
                     TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                     +g+W++eEd+ l+ +++++G+g +W + ++++g +R++k+c++rw++yl
       AA30G00287 14 KGPWSPEEDDVLKSYIEKHGTGgNWISLPQKIGIKRCGKSCRLRWLNYL 62
                     79*******************************55************97 PP

2Myb_DNA-binding361.6e-1169111246
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      g +T eEd ++  +    G++ W+ Ia+ ++ gRt++++k++w++
       AA30G00287  69 GGFTDEEDYIICSLYISIGSR-WSIIASQLP-GRTDNDIKNYWNT 111
                      569******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129420.683966IPR017930Myb domain
SuperFamilySSF466891.63E-2612109IPR009057Homeodomain-like
SMARTSM007172.9E-121364IPR001005SANT/Myb domain
PfamPF002491.3E-151462IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.1E-241569IPR009057Homeodomain-like
CDDcd001671.56E-81662No hitNo description
SMARTSM007172.3E-1067115IPR001005SANT/Myb domain
PROSITE profilePS5129415.27767117IPR017930Myb domain
PfamPF002498.1E-1069111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.2E-2270117IPR009057Homeodomain-like
CDDcd001671.87E-671111No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 309 aa     Download sequence    Send to blast
MGRAPCCDKS TVKKGPWSPE EDDVLKSYIE KHGTGGNWIS LPQKIGIKRC GKSCRLRWLN  60
YLRPNLKHGG FTDEEDYIIC SLYISIGSRW SIIASQLPGR TDNDIKNYWN TKLKKKLLNK  120
QGKIFQELNV KFETETTSKR SMSNQNQVLM FHDENIKPQN QILNQSTYDF GMEEQSLIKN  180
HMETFSWEPN KVWYHDHDHH DHHDNSNAMN GLLGSSSSPS LNSISSSCSI STNSSLQISP  240
YTFNTNHQDM FLTGLETLEA ELLGENVIKN SEEIEFRRGI QLQNDNFLDH DVSSLINYGL  300
DDNVIFKSR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-23141177108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013589662.11e-128PREDICTED: transcription factor RAX3
RefseqXP_013722975.11e-128PREDICTED: transcription factor RAX3-like
SwissprotQ9M2Y94e-79RAX3_ARATH; Transcription factor RAX3
TrEMBLA0A078C2N81e-128A0A078C2N8_BRANA; BnaC01g01250D protein
TrEMBLA0A0D3A1651e-128A0A0D3A165_BRAOL; Uncharacterized protein
STRINGAT4G37780.11e-120(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37780.18e-93myb domain protein 87